Glp – 1 – 10MG
Helio Peptides – GLP-1 is a high-purity peptide offered in a 10mg lyophilized powder format, intended strictly for laboratory research and development purposes. Manufactured to exceed 99% purity and tested using both HPLC and LC-MS protocols, this peptide is supplied in a sterile, sealed vial to ensure stability and integrity.
About Glp – 1 – 10MG
GLP-1 (7-37) is the fully processed, biologically active form of glucagon-like peptide-1, a 30-amino-acid incretin hormone derived from the proglucagon gene and secreted by intestinal L-cells.. In experimental systems it is characterized as an endogenous agonist of the glucagon-like peptide-1 receptor (GLP-1R), a class B G-protein-coupled receptor.. Because "GLP-1" is a generic class designation rather than a single proprietary molecule, laboratory reference material most commonly corresponds to the native GLP-1 (7-37) or GLP-1 (7-36) amide sequence.
Research use only — not for human or animal consumption. Per-batch documentation is provided with the material.
Handling and Storage Tips:
Keep peptides cold and away from light once received.
For short-term use (days to weeks), refrigeration at 4°C (39°F) is acceptable.
Lyophilized peptides are typically stable at room temperature for several weeks, making it suitable for moderate-term storage.
For long-term storage (months to years), it’s best to freeze peptides at -80°C (-112°F). Freezing optimally preserves peptide stability for extended periods.
FDA Disclosure & Intended Use:
FDA Disclosure: The statements on this website and the products sold herein have not been evaluated by the U.S. Food and Drug Administration (FDA). These products are not intended to diagnose, treat, cure, or prevent any disease. Products sold are for Research Use Only and are not for human or animal use.
Intended Purpose: Products sold on this site are intended solely for basic laboratory research, pharmaceutical research, or the development of new tests. They are not intended for diagnostic, therapeutic, or clinical use.
Specifications
- MaterialGlp – 1 – 10MG
- Also searched asGLP1, GLP 1
- Research AreaMetabolic Research
- Presentation—
- CAS Number106612-94-6
- Molecular FormulaC151H228N40O47
- Molecular Weight3355.71 g/mol
- TypeLinear peptide (incretin hormone)
- Receptor / TargetGlucagon-like peptide-1 receptor (GLP-1R)
- PubChem CID44290899 →
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
- Purity (HPLC)≥99%
- Identity (MS)Confirmed to specification
- TestingAccredited (ISO 17025) third-party laboratory
- DocumentationPer-batch COA →
These observations are drawn from experimental and in-vitro settings and are provided for scientific context only.. No human efficacy, handling, or therapeutic conclusions are implied.
Glucagon-like peptide-1 was identified in the 1980s following the cloning of the proglucagon gene, and the truncated GLP-1 (7-37) and GLP-1 (7-36) amide forms were subsequently established as the active incretin species by Orskov, Holst, and colleagues. This work laid the biochemical foundation for the incretin field and the later development of GLP-1 receptor agonists and DPP-4 inhibitors.
- Orskov C, Holst JJ, et al. (1989). Complete sequences of glucagon-like peptide-1 from human and pig small intestine. Journal of Biological Chemistry.
- Mojsov S, Weir GC, Habener JF (1987). Journal of Clinical Investigation.
- Holst JJ (2007). The physiology of glucagon-like peptide 1. Physiological Reviews.
View compound profile on NIH PubChem →
Cited literature refers to laboratory and preclinical research. This material is supplied strictly for research use only and is not intended to diagnose, treat, cure, or prevent any disease.
Are these research materials third-party tested?
Yes — every batch is analysed by an accredited (ISO 17025) independent laboratory using HPLC and mass spectrometry, with a per-batch Certificate of Analysis.
What purity are the materials?
Materials are verified to 99%+ HPLC purity. Any batch that does not meet the threshold is not released.
Do you provide a Certificate of Analysis (COA)?
Yes. Per-batch COA documentation is provided and is traceable by lot number.
Where do you ship from?
Materials are shipped from the USA in discreet, protective packaging.
Are these products for human use?
No. All materials are sold strictly for laboratory research use only — not for human or animal consumption, diagnosis, treatment, or prevention of any disease.
More Metabolic Research materials
RESEARCH USE ONLY · NOT FOR HUMAN OR VETERINARY USE · 21+
