GLP-1 Dissolvable Strips
About GLP-1 Dissolvable Strips
GLP-1 (7-37) is the fully processed, biologically active form of glucagon-like peptide-1, a 30-amino-acid incretin hormone derived from the proglucagon gene and secreted by intestinal L-cells.. In experimental systems it is characterized as an endogenous agonist of the glucagon-like peptide-1 receptor (GLP-1R), a class B G-protein-coupled receptor.. Because "GLP-1" is a generic class designation rather than a single proprietary molecule, laboratory reference material most commonly corresponds to the native GLP-1 (7-37) or GLP-1 (7-36) amide sequence.
Format: supplied as dissolvable oral strips (10 per box) — a fast, non-invasive research format.. Exact per-strip potency is printed on the packaging.
Research use only — not for human or animal consumption. Per-batch documentation is provided with the material.
GLP-1 is an incretin peptide central to metabolic, appetite, and glucose-regulation research.
Supplied as dissolvable oral strips — 10 strips per box — for fast, consistent, non-invasive handling in the research setting. Exact per-strip potency is printed on the packaging.
Every batch is independently tested by an ISO 17025-accredited laboratory to ≥99% purity, with a certificate of analysis on file for its exact lot.
For research use only. Not for human or veterinary consumption, diagnosis, or treatment.
Specifications
- MaterialGLP-1 Dissolvable Strips
- Also searched asGLP1, GLP 1
- Research AreaMetabolic Research
- PresentationDissolvable Strips
- CAS Number106612-94-6
- Molecular FormulaC151H228N40O47
- Molecular Weight3355.71 g/mol
- TypeLinear peptide (incretin hormone)
- Receptor / TargetGlucagon-like peptide-1 receptor (GLP-1R)
- PubChem CID44290899 →
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
- Purity (HPLC)≥99%
- Identity (MS)Confirmed to specification
- TestingAccredited (ISO 17025) third-party laboratory
- DocumentationPer-batch COA →
These observations are drawn from experimental and in-vitro settings and are provided for scientific context only.. No human efficacy, handling, or therapeutic conclusions are implied.
Glucagon-like peptide-1 was identified in the 1980s following the cloning of the proglucagon gene, and the truncated GLP-1 (7-37) and GLP-1 (7-36) amide forms were subsequently established as the active incretin species by Orskov, Holst, and colleagues. This work laid the biochemical foundation for the incretin field and the later development of GLP-1 receptor agonists and DPP-4 inhibitors.
- Orskov C, Holst JJ, et al. (1989). Complete sequences of glucagon-like peptide-1 from human and pig small intestine. Journal of Biological Chemistry.
- Mojsov S, Weir GC, Habener JF (1987). Journal of Clinical Investigation.
- Holst JJ (2007). The physiology of glucagon-like peptide 1. Physiological Reviews.
View compound profile on NIH PubChem →
Cited literature refers to laboratory and preclinical research. This material is supplied strictly for research use only and is not intended to diagnose, treat, cure, or prevent any disease.
Are these research materials third-party tested?
Yes — every batch is analysed by an accredited (ISO 17025) independent laboratory using HPLC and mass spectrometry, with a per-batch Certificate of Analysis.
What purity are the materials?
Materials are verified to 99%+ HPLC purity. Any batch that does not meet the threshold is not released.
Do you provide a Certificate of Analysis (COA)?
Yes. Per-batch COA documentation is provided and is traceable by lot number.
Where do you ship from?
Materials are shipped from the USA in discreet, protective packaging.
Are these products for human use?
No. All materials are sold strictly for laboratory research use only — not for human or animal consumption, diagnosis, treatment, or prevention of any disease.
More Metabolic Research materials
RESEARCH USE ONLY · NOT FOR HUMAN OR VETERINARY USE · 21+
